PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 678aa    MW: 76868.6 Da    PI: 5.9357
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003870.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.98.6e-1143066733372
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lL+ecAeav+s d+++a++lL+++++++sp+gd++qRla+yf+ +L+arla+  +  y  l + +      +e l+a+++++ ++P+ k+ h+ aN+
  Pbr003870.1 306 RLLTECAEAVASYDQQAASELLKQIRQHSSPYGDSTQRLAHYFADGLEARLAGARTPSYCPLMMHSP----ATEILKAYQVYVTACPFKKMVHFFANR 399
                  79***************************************************55555544444333....589************************ PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  +I++ +e+++r+HiiDf+ s+GlQWp+L+q+L+++++gpp+lRiT ++ p++g   +e++eet++rL+k++e+ +vpfe+nv +ak++e+++le++r+
  Pbr003870.1 400 TIMKTAEKATRLHIIDFGSSYGLQWPCLIQSLSEKTGGPPNLRITLIELPQPGfrPAERIEETARRLTKYCERYNVPFEYNV-LAKKWETIRLEDFRM 496
                  ****************************************************9*****************************.6************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +++E+++Vn++++l++++de+v  +++rd+vL+l+ksl+P+++v+   +  +n++ F+ rf +al ++ ++fd++ea++p+e+e+r+  Er+++gr+i
  Pbr003870.1 497 DRNEVTVVNCMHRLKHMPDETVMANNPRDAVLNLIKSLNPDLFVHGVVNGTYNAPAFVPRFKQALFHFYTFFDMYEATVPHEDEQRMLFERAIFGRDI 594
                  ************************************************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                  +nv+aceg er+er et+++W++r  + GFk++pl+ +  k++k++ + ++  + +r+e++ +++++gWk+r +++++a
  Pbr003870.1 595 MNVIACEGLERVERPETYKQWQARYARIGFKQLPLDRELLKKVKTMSKVMGyHRDFRIEDDGQWMLQGWKGRIVIALTA 673
                  ***********************************************99999999*******************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.166278654IPR005202Transcription factor GRAS
PfamPF035143.0E-111306673IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MEGFEFGDGS NLVYSDENLA DGFRENHEST NPNYIPSNLD HPSDLSTSLI PGSDAVTIDT  60
NDCNQPVLKY ISDILLEEDL EGKPCMLQES LALQVAEKYF YDALNPEDPP LLNQPSFSVC  120
QSFENLDVGC HSSDGSIASF PSSNGSISAN RGWVWDLSQP SHGIKFLPNE SCETIDLERD  180
QLVPPCSDQW PPGPYTLIGN LASENDGYNS INGPKGKKNH RREDGYDAEE GRRNKQSATA  240
SDNSDLQEIY DTVLQSVNHE PDSCLHDESS KTKGNRMLQH KEQSKGSKSS RAKKQNSNRK  300
VVDLCRLLTE CAEAVASYDQ QAASELLKQI RQHSSPYGDS TQRLAHYFAD GLEARLAGAR  360
TPSYCPLMMH SPATEILKAY QVYVTACPFK KMVHFFANRT IMKTAEKATR LHIIDFGSSY  420
GLQWPCLIQS LSEKTGGPPN LRITLIELPQ PGFRPAERIE ETARRLTKYC ERYNVPFEYN  480
VLAKKWETIR LEDFRMDRNE VTVVNCMHRL KHMPDETVMA NNPRDAVLNL IKSLNPDLFV  540
HGVVNGTYNA PAFVPRFKQA LFHFYTFFDM YEATVPHEDE QRMLFERAIF GRDIMNVIAC  600
EGLERVERPE TYKQWQARYA RIGFKQLPLD RELLKKVKTM SKVMGYHRDF RIEDDGQWML  660
QGWKGRIVIA LTALKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-443086298328GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364371.10.0PREDICTED: scarecrow-like protein 30
TrEMBLM5W7A20.0M5W7A2_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-162SCARECROW-like 14